top of page

CircRNA

Gene

chr13|111233204|111267670|+|4|circRNA|ARHGEF7|ENST00000317133.9|6,7,8,9

ARHGEF7

CircRNA UID

circARHGEF7(6,7,8,9)

Open Reading Frame (ORF)

LLFKPDATDENPVPHVLCQSPFCSECPHGTQRSLCLPNQEH

Peptide

LLFKPDATDENPVPHVLCQSPFCSECPHGTQR

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

31

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page