top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|110676973|110688018|-|4|circRNA|CARS2|NM_024537|7,6,5,4

CARS2

Open Reading Frame (ORF)

LTSVMPVTSPCGRRPNPRRCSGPLPGDPGGRAGTSSALPSLDEYFPRFPRQSL

Peptide

AGTSSALPSLDEYFPRFPR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page