top of page

CircRNA

Gene

chr13|106512528|106512812|-|1|circRNA|EFNB2|NM_004093|2

EFNB2

Open Reading Frame (ORF)

LLASMNIIKFIWLIKTKQTDALLRRKIPLSSTVPNQTKISNSPSSFKNSALTSGV

Peptide

LLASMNIIKFIWLIK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page