top of page

CircRNA

Gene

chr13|101575423|101583356|+|3|circRNA|ITGBL1|ENST00000618057.4|3,4,5

ITGBL1

CircRNA UID

circITGBL1(3,4,5)

Open Reading Frame (ORF)

MLIRLGTGEIFMGTPVNVMRGTVELSMTDILMTSVQVHVTVAGVSVIIQMEVDLCMVNFVSVTIENA

Peptide

LGTGEIFMGTPVNVMR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page