top of page

CircRNA

Gene

chr12|95262905|95282644|+|5|circRNA|VEZT|ENST00000436874.5|4,5,6,7,8

VEZT

CircRNA UID

circVEZT(4,5,6,7,8)

Open Reading Frame (ORF)

LGGTEFRVLQTVSPITFYSQFTSWALTYSSTSASSYLI

Peptide

LGGTEFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page