top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|95172599|95211267|—|2|circRNA|FGD6|ENST00000343958.8|3,2

FGD6

Open Reading Frame (ORF)

LKALTTLIVNMKAIRAMIIFHQCVPAVLSVSISWAIERICV

Peptide

ALTTLIVNMK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page