top of page

CircRNA

Gene

chr12|94367793|94403262|-|7|circRNA|CEP83|ENST00000397809.9|11,10,9,8,7,6,5

CEP83

CircRNA UID

circCEP83(11,10,9,8,7,6,5)

Open Reading Frame (ORF)

MMSGGNLKRISMKRNCGLHRWQKRSPGRSFRVLDINSTKIGIAKSPNTTRIRNSNERTF

Peptide

IGIAKSPNTTR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page