top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|94367793|94403262|—|7|circRNA|CEP83|ENST00000397809.9|11,10,9,8,7,6,5

CEP83

Open Reading Frame (ORF)

MMSGGNLKRISMKRNCGLHRWQKRSPGRSFRVLDINSTKIGIAKSPNTTRIRNSNERTF

Peptide

SPNTTRIR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page