top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|9299468|9299958|+|1|ciRNA|RP11—22B23.1|ENST00000539757.1|10

RP11-22B23.1

Open Reading Frame (ORF)

LGSPGSRASWHYWGWYLGARKAGAFLVKPQGEGGCQELRRVCCIHLFTNGFPSDAPNFHAYDVMEDVSDRTIQFSSFSFL

Peptide

LGSPGSR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page