top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|92798891|92802734|-|3|circRNA|EEA1|ENST00000322349.12|21,20,19

EEA1

Open Reading Frame (ORF)

LKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIAVLQKSIQYKIGSTEKI

Peptide

IAVLQKSIQYK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page