top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|89350587|89351025|—|1|circRNA|DUSP6|ENST00000279488.7|2

DUSP6

Open Reading Frame (ORF)

LTLPRTSSLTLTETPIVQQTRMVVRCPTASLPSQWRSCPSSTWAVPKTPPTWTCWRNSASSTS

Peptide

SCPSSTWAVPK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page