top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|82857009|82930545|+|3|circRNA|TMTC2|ENST00000551915.5|2,3,4

TMTC2

Open Reading Frame (ORF)

LKLKAPIEMLCTTAATWLTCFIISVLSRLIRTFSQKLHGRTFSTMIFGGLF

Peptide

APIEMLCTTAATWLTCFIISVLSRLIR

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page