top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|78006418|78059115|+|5|circRNA|NAV3|ENST00000536525.6|8,9,10,11,12

NAV3

Open Reading Frame (ORF)

MTDGGLNLYTRSLNRIPDTATSRDIIQRGVHDVTVDADRFLQRTSIVFRCKW

Peptide

GVHDVTVDADRFLQR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page