top of page

CircRNA

Gene

chr12|76059797|76074239|—|5|circRNA|NAP1L1|ENST00000618691.4|6,5,4,3,2

NAP1L1

Open Reading Frame (ORF)

LKLLMQFMNLRKKNVNGNQMKKMRFRYLEFLQHGRH

Peptide

LKLLMQFMNLR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page