top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|7403534|7432736|-|3|circRNA|CD163L1|ENST00000313599.7|6,5,4

CD163L1

Open Reading Frame (ORF)

LELLIALLYCAPFGWMTFYARGMSWHSGIADIVDGEIMTAVTMRMSH

Peptide

LELLIALLYCAPFGWMTFYAR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page