top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|71642435|71657301|—|5|circRNA|ZFC3H1|ENST00000378743.7|6,5,4,3,2

ZFC3H1

Open Reading Frame (ORF)

LIVEEAFISMITMKKLLWIQIVKPVLQPKVLEGLHQENKIIHQKMKTVWKKLLKICF

Peptide

VLEGLHQENK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page