top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|71636489|71647813|—|7|circRNA|ZFC3H1|ENST00000378743.7|9,8,7,6,5,4,3

ZFC3H1

Open Reading Frame (ORF)

LNNSHPVPRSNLSIVSINTVSQPRIQNPKFHRGPRLPRTVISDYKIKNKI

Peptide

TVISDYK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page