top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|71626259|71637059|—|15|circRNA|ZFC3H1|ENST00000378743.7|22,21,20,19,18,17,16,15,14,13,12,11,10,9,8

ZFC3H1

Open Reading Frame (ORF)

MWKACVFLLNLYLLYHHYHLSHLKIQNSLQNHLLQMRKRRKKCCFEKNYLNL

Peptide

IQNSLQNHLLQMR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page