top of page

CircRNA

Gene

chr12|70656703|70754301|-|9|circRNA|PTPRR|NM_001207016|10,9,8,7,6,5,4,3,2

PTPRR

Open Reading Frame (ORF)

LKEEGVVDALSIVCQLRMDRKMFYKGSMKRTKSGAKKDFMLLSFFSASLLL

Peptide

KDFMLLSFFSASLLL

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page