top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|6957653|6958073|+|2|circRNA|PTPN6|ENST00000399448.5|10,11

PTPN6

Open Reading Frame (ORF)

MGSPVSLGVSSASWTRSTSGRKVCLTQGPSSCTAEQMRPILARGGHAACLWALLCDQLRGA

Peptide

GGHAACLWALLCDQLR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page