top of page

CircRNA

Gene

chr12|68648698|68654252|+|4|circRNA|RAP1B|NM_001010942|2,3,4,5

RAP1B

CircRNA UID

circRAP1B(2,3,4,5)

Open Reading Frame (ORF)

MRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVLGFDKLASCVSIS

Peptide

DTDDVLGFDK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page