top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|6837086|6837372|+|1|ciRNA|P3H3|NM_014262|10

P3H3

Open Reading Frame (ORF)

LEERLCRKPGPRAWAFVKELSWDRDYLIGPSVEKRDVLRAGAGVVVMEREGAVWADGQSWMLTDSKPMGGERQSWAGARAETVSTGGTRARLMPRPGGEAVQEAGPQGLGFCEGAFLGPRLPDRTQRGEKGCSESWGRGCCHGERRSSLG

Peptide

AGAGVVVMER

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page