top of page

CircRNA

Gene

chr12|56643402|56645353|-|4|circRNA|ATP5B|NM_001686|5,4,3,2

ATP5B

CircRNA UID

circATP5B(5,4,3,2)

Open Reading Frame (ORF)

MPPLSQGLCGANISFAKSRRRHRAHRGGHWRSGGRPV

Peptide

GGHWRSGGRPV

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page