top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|56613256|56613952|-|1|ciRNA|BAZ2A|NM_001300905|4

BAZ2A

Open Reading Frame (ORF)

LLSDFFLIILLCRFGGYVPLTYPCRVAKLYLKETVKWEKY

Peptide

LLSDFFLIILLCR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page