top of page

CircRNA

Gene

chr12|56274776|56282991|—|5|circRNA|CS|ENST00000549143.5|9,8,7,6,5

CS

Open Reading Frame (ORF)

LAKMCQMRSYETTSGTHSTQDGASVSEALVSLNARNCYPRLRVGKNPCLRAYFGCW

Peptide

ASVSEALVSLNARNCYPR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page