top of page

CircRNA

Gene

chr12|56216544|56221902|-|1|ciRNA|RNF41|ENST00000551711.5|1

RNF41

CircRNA UID

ciRNF41(1)

Open Reading Frame (ORF)

LGNWVVGRRGLEEEQKARRGEGVLLEGLTDCFPVQKLHFI

Peptide

LGNWVVGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page