top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|56092746|56094556|+|6|circRNA|ERBB3|ENST00000267101.7|10,11,12,13,14,15

ERBB3

Open Reading Frame (ORF)

LCSMCPFSRWAPLCEQLPPWSPRCQGPNLQVPRCSE

Peptide

WAPLCEQLPPWSPRCQGPNLQVPR

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page