top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|535165|553983|+|13|circRNA|B4GALNT3|ENST00000266383.9|2,3,4,5,6,7,8,9,10,11,12,13,14

B4GALNT3

Open Reading Frame (ORF)

MGKWQRRPLPPTTRMPGCLREDRHLPPPWSKMPLTTASEACGNSWLSPGRACWPPSPSGTPQRPSQGGPATFQCSSQRRGSKNPALSPAKIHLIPTSGLLGTL

Peptide

MPLTTASEACGNSWLSPGR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page