top of page

CircRNA

Gene

chr12|51055834|51056502|+|3|circRNA|LETMD1|ENST00000551477.5|5,6,7

LETMD1

CircRNA UID

circLETMD1(5,6,7)

Open Reading Frame (ORF)

LSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSVPVSQATTDQAFLDPKTTN

Peptide

SVPVSQATTDQAFLDPKTTN

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

12

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page