top of page

CircRNA

Gene

chr12|51049033|51056502|+|6|circRNA|LETMD1|ENST00000551477.5|2,3,4,5,6,7

LETMD1

Open Reading Frame (ORF)

LSRAMLLTSYLPPPLLRHRLKTHTTVIHQLDKALAKLGIGQLTAQEVKSVFKASPFSKGRCEELDVLCGNQDKSD

Peptide

LGIGQLTAQEVKSVFK

ORF Found in Long-Read

true

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page