top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|49269493|49272669|—|1|ciRNA|RP11—161H23.5|ENST00000550468.2|1

RP11-161H23.5

Open Reading Frame (ORF)

LEFCQVNIQGSIKSQGSSDGGHNLANKAVKVSVGWALDIEVSTTDVIDGLIVYHEGTIRVLQGGVGGEDGVVGLNYSCGNLGRRVNGELQLGLLAIIN

Peptide

LEFCQVNIQGSIKSQGSSDGGHNLANK

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page