top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|49097565|49098105|-|2|circRNA|LMBR1L|ENST00000553040.5|7,6

LMBR1L

Open Reading Frame (ORF)

LGVGRKKLDTAICCLGLEGSPRLLGPQDLESERGSLALTCWVTLDASTGWAISTLCSSTTQPLQASPHSVW

Peptide

LDTAICCLGLEGSPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page