top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|48063709|48098124|—|12|circRNA|SENP1|ENST00000552189.5|14,13,12,11,10,9,8,7,6,5,4,3

SENP1

Open Reading Frame (ORF)

MEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEMILLIG

Peptide

KDIQTLNHLNWLNDEMILLIG

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page