top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|40028300|40048210|—|2|circRNA|SLC2A13|ENST00000280871.8|3,2

SLC2A13

Open Reading Frame (ORF)

LQQFRRLYSFLAFSFCLKALDGLFRKDRLRRPVEFYLRCVVTRPLMRNMIASKTTLKRRKKRLAQALLL

Peptide

ALDGLFR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page