top of page

CircRNA

Gene

chr12|32327460|32338979|+|4|circRNA|BICD1|ENST00000281474.9|5,6,7,8

BICD1

CircRNA UID

circBICD1(5,6,7,8)

Open Reading Frame (ORF)

LKGPPSMSEFIQGHRLSKEKRLTVAPPGRAGKGHSFGQPTGVTDTAGTHQGGTDGAA

Peptide

LTVAPPGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page