top of page

CircRNA

Gene

chr12|22482556|22493337|-|4|circRNA|C2CD5|NM_001286173|15,14,13,12

C2CD5

CircRNA UID

circC2CD5(15,14,13,12)

Open Reading Frame (ORF)

LPFMEYEVHTQLMNKLKLKGMNALFGLRIQITVGENMLMGLAMNQKLEMHGGQKSDKK

Peptide

IQITVGENMLMGLAMNQKLEMHGGQK

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

12

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page