top of page

CircRNA

Gene

chr12|20613442|20621411|+|3|circRNA|PDE3A|NM_000921|3,4,5

PDE3A

CircRNA UID

circPDE3A(3,4,5)

Open Reading Frame (ORF)

MMTLTKSRSFTSSYAISAANHVKAKKQSRPVFRNQYYCGHRRHGRGPRPHYRPPGRPFSSTKRVHILESREQLAQHTAHLPGHSQAQSESRHFAQ

Peptide

KQSRPVFR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page