top of page

CircRNA

Gene

chr12|19253939|19274983|+|7|circRNA|PLEKHA5|NM_001143821|4,5,6,7,8,9,10

PLEKHA5

Open Reading Frame (ORF)

MLAWQILEVEIAPIQGPYTQRPIESYREQIQCSSWNSGLKSRRGGVMKKKPGAIMKGK

Peptide

KPGAIMK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page