top of page

CircRNA

Gene

chr12|132776633|132777090|-|2|circRNA|GOLGA3|ENST00000204726.7|21,20

GOLGA3

Open Reading Frame (ORF)

MGGGSERKRNPVLEAAAGLDGAAGQEGTGRATAAAAGFGRGNIPRR

Peptide

ATAAAAGFGRGNIPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page