top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|13055550|13071396|+|9|circRNA|KIAA1467|ENST00000197268.12|2,3,4,5,6,7,8,9,10

KIAA1467

Open Reading Frame (ORF)

MIHLPRLTVMRAKTIWCLTCRRMEGSKMGRVLWEKRQNPTQMLRLQRLQSHIFQKSPRRATPQNPLGAWNRRRPPPWCHMCARLSSC

Peptide

MEGSKMGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page