top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|128926358|128957643|+|5|circRNA|GLT1D1|ENST00000441390.6|6,7,8,9,10

GLT1D1

Open Reading Frame (ORF)

MDLEVPVLARNIPGNAAVVKHEVTGLLFSNPQRLTKVLIICTYFF

Peptide

HEVTGLLFSNPQR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page