top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|123484179|123499536|—|4|circRNA|RILPL1|ENST00000376874.8|6,5,4,3

RILPL1

Open Reading Frame (ORF)

MEEENRIPQPPPIAHPRTSPQPESGIKRLHVRAGATGDEEAEGGGGQTTRRDPRQGQGAGPEK

Peptide

QGQGAGPEK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page