top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|122994800|123005548|—|9|circRNA|PITPNM2|ENST00000320201.8|14,13,12,11,10,9,8,7,6

PITPNM2

Open Reading Frame (ORF)

LSPAHAIPAAPPCWMAQVPWAGLTLRSPTSSSSGARWGWSWP

Peptide

SPTSSSSGAR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page