top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|122278153|122341697|—|14|circRNA|CLIP1|ENST00000361654.8|22,21,20,19,18,17,16,15,14,13,12,11,10,9

CLIP1

Open Reading Frame (ORF)

MEVQTGDCHRIPPAGDGRTEGIFQQRAWNRDGRIC

Peptide

IPPAGDGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page