top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|121439856|121445418|—|8|circRNA|KDM2B|NM_001005366|21,20,19,18,17,16,15,14

KDM2B

Open Reading Frame (ORF)

MDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLSASAAPHRRVPCVWRGGEGRHGGRGGRQV

Peptide

HGGRGGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page