top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|121268637|121274585|—|4|circRNA|CAMKK2|NM_001270485|5,4,3,2

CAMKK2

Open Reading Frame (ORF)

LWSPSVSRAVLWTSAWRGTGPWRPMAKRSPLTPPGPRPGPTSPVASCLCKSGPRVGWQPVAAWT

Peptide

GTGPWRPMAK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page