top of page

CircRNA

Gene

chr12|12121085|12164562|—|15|circRNA|LRP6|ENST00000538239.5|22,21,20,19,18,17,16,15,14,13,12,11,10,9,8

LRP6

Open Reading Frame (ORF)

MIQNLCPHLPHPEANTCQQRRTMKAAHLLHTQRGAILITSTHRHPLPVQTPPEEGPSSSDCLQRKNVPTPVLRKTGDVAISASIDLRAFAVLALLALNSSVT

Peptide

KTGDVAISASIDLR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page