top of page

CircRNA

Gene

chr12|118389946|118391097|+|1|ciRNA|SUDS3|ENST00000543473.1|5

SUDS3

Open Reading Frame (ORF)

LKVHSSEVLTSLAHHRPLCQSPQWRDLKSGGIYNFCLSIISIYVYFGVQALTKCCSILLSCCIKNNSNFLNIHNLSRIYFPLKL

Peptide

LKVHSSEVLTSLAHHRPLCQSPQWR

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page