top of page

CircRNA

Gene

chr12|116006305|116007636|—|2|circRNA|MED13L|ENST00000281928.7|12,11

MED13L

Open Reading Frame (ORF)

MDLVPRMSLHQVIPRRCLMGKMPCLFSVLLLKQTLSTT

Peptide

MDLVPRMSLHQVIPR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page