top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|112279227|112319742|-|8|circRNA|HECTD4|ENST00000550722.5|9,8,7,6,5,4,3,2

HECTD4

Open Reading Frame (ORF)

LPLKMLRKTPIYTCGTYLVMLVPPPGGSGSSATRSLFGGTSGLSSLKNFNL

Peptide

SLFGGTSGLSSLKNFNL

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page